Lineage for d1wiya_ (1wiy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005005Protein Cyp175a1 [81869] (1 species)
    thermostable P450
  7. 2005006Species Thermus thermophilus [TaxId:274] [81870] (2 PDB entries)
    Uniprot Q53W59
  8. 2005009Domain d1wiya_: 1wiy A: [114684]
    complexed with hem

Details for d1wiya_

PDB Entry: 1wiy (more details), 2 Å

PDB Description: Crystal Structure Analysis of a 6-coordinated Cytochorome P450 from Thermus thermophilus HB8
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d1wiya_:

Sequence, based on SEQRES records: (download)

>d1wiya_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]}
mkrlslreawpylkdlqqdplavllewgrahprlflplprfplalifdpegvegallaeg
ttkatfqyralsrltgrglltdwgkswkearkalkdpflpksvrgyreameeeawaffge
wrgeerdldhemlalslrllgralfgkplspslaehalkaldrimaqtrsplalldlaae
arfrkdrgalyreaealivhpplshlpreralseavtllvaghetvasaltwsflllshr
pdwqkrvaeseeaalaafqealrlyppawiltrrlerplllgedrlpqgttlvlspyvtq
rlyfpegeafqperflaergtpsgryfpfglgqrlclgrdfallegpivlraffrrfrld
plpfprvlaqvtlrpegglparpre

Sequence, based on observed residues (ATOM records): (download)

>d1wiya_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]}
mkrlsldplavllewgrahprlflpplalifdpegvegallaegttkatfqyralsrltg
rglltdwgkswkearkalkdpflpksvrgyreameeeawaffgewrgeerdldhemlals
lrllgralfgkplspslaehalkaldrimlaaearfrkdrgalyreaealivhpplshlp
reralseavtllvaghetvasaltwsflllshrpdwqkrvaeseeaalaafqealrlypp
awiltrrlerplllgedrlpqgttlvlspyvtqrlyfpegeafqperflaergtpsgryf
pfglgqrlclgrdfallegpivlraffrrfrldplpfprvlaqvtlrpegglparpre

SCOPe Domain Coordinates for d1wiya_:

Click to download the PDB-style file with coordinates for d1wiya_.
(The format of our PDB-style files is described here.)

Timeline for d1wiya_: