PDB entry 1wiu

View 1wiu on RCSB PDB site
Description: twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, 30 structures
Class: muscle protein
Keywords: immunoglobulin superfamily, I set, muscle protein
Deposited on 1996-06-23, released 1996-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: twitchin 18th igsf module
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: UNC-22
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wiua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wiuA (A:)
lkpkiltasrkikikagfthnlevdfigapdptatwtvgdsgaalapellvdakssttsi
ffpsakradsgnyklkvknelgedeaifevivq