PDB entry 1wii

View 1wii on RCSB PDB site
Description: Solution structure of RSGI RUH-025, a DUF701 domain from mouse cDNA
Class: Structural genomics, unknown function
Keywords: domain of unknown function, zinc finger, metal-binding protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical UPF0222 protein MGC4549
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 3110032N15
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60003 (7-78)
    • cloning aetifact (0)
    • cloning artifact (1-6)
    • cloning artifact (79-84)
  Domains in SCOPe 2.08: d1wiia1, d1wiia2, d1wiia3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wiiA (A:)
  gssgssgrkpppkkkmtgtletqftcpfcnhekscdvkmdrarntgvisctvcleefqtp
  itylsepvdvysdwidacesgpssg