Lineage for d1wiia1 (1wii A:2-79)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036360Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 3036467Family g.41.3.4: Putative zinc binding domain [118285] (1 protein)
    Pfam PF05129; DUF701
  6. 3036468Protein Hypothetical UPF0222 protein MGC4549 [118286] (1 species)
  7. 3036469Species Mouse (Mus musculus) [TaxId:10090] [118287] (1 PDB entry)
    Uniprot P60003
  8. 3036470Domain d1wiia1: 1wii A:2-79 [114673]
    Other proteins in same PDB: d1wiia2, d1wiia3
    Structural genomics target
    complexed with zn

Details for d1wiia1

PDB Entry: 1wii (more details)

PDB Description: solution structure of rsgi ruh-025, a duf701 domain from mouse cdna
PDB Compounds: (A:) Hypothetical UPF0222 protein MGC4549

SCOPe Domain Sequences for d1wiia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wiia1 g.41.3.4 (A:2-79) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]}
ssgssgrkpppkkkmtgtletqftcpfcnhekscdvkmdrarntgvisctvcleefqtpi
tylsepvdvysdwidace

SCOPe Domain Coordinates for d1wiia1:

Click to download the PDB-style file with coordinates for d1wiia1.
(The format of our PDB-style files is described here.)

Timeline for d1wiia1: