![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) ![]() |
![]() | Family g.41.3.4: Putative zinc binding domain [118285] (1 protein) Pfam PF05129; DUF701 |
![]() | Protein Hypothetical UPF0222 protein MGC4549 [118286] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [118287] (1 PDB entry) Uniprot P60003 |
![]() | Domain d1wiia1: 1wii A:2-79 [114673] Other proteins in same PDB: d1wiia2, d1wiia3 Structural genomics target complexed with zn |
PDB Entry: 1wii (more details)
SCOPe Domain Sequences for d1wiia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiia1 g.41.3.4 (A:2-79) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} ssgssgrkpppkkkmtgtletqftcpfcnhekscdvkmdrarntgvisctvcleefqtpi tylsepvdvysdwidace
Timeline for d1wiia1: