PDB entry 1wig

View 1wig on RCSB PDB site
Description: Solution structure of RSGI RUH-019, a LIM domain of actin binding LIM protein 2 (KIAA1808 protein) from human cDNA
Class: Structural genomics, unknown function
Keywords: LIM DOMAIN, ZINC FINGER, METAL-BINDING PROTEIN, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-28, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1808 protein
    Species: HOMO SAPIENS
    Gene: mRNA for KIAA1808 protein, partial cds.
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6H8Q1 (7-66)
      • cloning artifact (0-6)
      • cloning artifact (67-72)
    Domains in SCOP 1.73: d1wiga1, d1wiga2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wigA (A:)
gssgssgcdscekyitgrvleagekhyhpscalcvrcgqmfaegeemylqgssiwhpacr
qaartedsgpssg