Class g: Small proteins [56992] (85 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Actin-binding LIM protein 2, abLIM2 [111441] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111442] (2 PDB entries) |
Domain d1wiga2: 1wig A:33-73 [114671] Structural genomics target; 1st LIM domain complexed with zn |
PDB Entry: 1wig (more details)
SCOP Domain Sequences for d1wiga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} lcvrcgqmfaegeemylqgssiwhpacrqaartedsgpssg
Timeline for d1wiga2: