PDB entry 1wia

View 1wia on RCSB PDB site
Description: Solution structure of mouse hypothetical ubiquitin-like protein BAB25500
Class: structural genomics, unknown function
Keywords: ubiquitin, 'STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical ubiquitin-like protein (RIKEN cDNA 2010008E23)
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2010008E23
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D8C5 (7-88)
      • cloning artifact (0-6)
      • cloning artifact (89-94)
    Domains in SCOPe 2.07: d1wiaa1, d1wiaa2, d1wiaa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wiaA (A:)
    gssgssginvrlkflndteelavarpedtvgtlkskyfpgqesqmkliyqgrllqdpart
    lsslnitnncvihchrsppgaavsgpsassgpssg