PDB entry 1wi3

View 1wi3 on RCSB PDB site
Description: Solution structure of the homeodomain of KIAA1034 protein
Class: DNA binding protein
Keywords: SATB2, homeodomain, helix-turn-helix, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein SATB2
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA fh00753
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UPW6 (7-64)
      • cloning artifact (0-6)
      • cloning artifact (65-70)
    Domains in SCOPe 2.07: d1wi3a1, d1wi3a2, d1wi3a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wi3A (A:)
gssgssgprsrtkislealgilqsfihdvglypdqeaihtlsaqldlpkhtiikffqnqr
yhvkhsgpssg