PDB entry 1wh0

View 1wh0 on RCSB PDB site
Description: Solution structure of the CS domain of human USP19
Class: Hydrolase
Keywords: USP, CS domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Hydrolase
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin carboxyl-terminal hydrolase 19
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hk08201
  Database cross-references and differences (RAF-indexed):
  • Uniprot O94966 (7-127)
    • cloning artifact (0-6)
    • cloning artifact (128-133)
  Domains in SCOPe 2.08: d1wh0a1, d1wh0a2, d1wh0a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wh0A (A:)
  gssgssgvdepesmvnlafvkndsyekgpdsvvvhvyvkeicrdtsrvlfreqdftlifq
  trdgnflrlhpgcgphttfrwqvklrnliepeqctfcftasridiclrkrqsqrwgglea
  paarvggasgpssg