SCOPe 2.08: Domain d1wh0a1: 1wh0 A:8-128

Lineage for d1wh0a1 (1wh0 A:8-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.3: GS domain [101580] (2 proteins)
   Pfam PF04969

6. Protein Ubiquitin carboxyl-terminal hydrolase 19, USP19 [117090] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117091] (1 PDB entry)
   Uniprot O94966 326-446

8. Domain d1wh0a1: 1wh0 A:8-128 [114628]
   Other proteins in same PDB: d1wh0a2, d1wh0a3
   Structural genomics target

Details for d1wh0a1

PDB Entry: 1wh0

PDB Description: solution structure of the cs domain of human usp19

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 19

SCOPe Domain Sequences for d1wh0a1:

Sequence; same for both SEQRES and ATOM records:

>d1wh0a1 b.15.1.3 (A:8-128) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]}
vdepesmvnlafvkndsyekgpdsvvvhvyvkeicrdtsrvlfreqdftlifqtrdgnfl
rlhpgcgphttfrwqvklrnliepeqctfcftasridiclrkrqsqrwggleapaarvgg
a

Timeline for d1wh0a1:

• d1wh0a1 first appeared in SCOP 1.71, called d1wh0a_
  
• d1wh0a1 appears in SCOPe 2.07