PDB entry 1wgx

View 1wgx on RCSB PDB site
Description: Solution structure of RSGI RUH-022, a myb DNA-binding domain in human cDNA
Class: structural genomics, unknown function
Keywords: myb DNA-binding domain, human cDNA, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1903 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA 20103310H23
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6P0N0 (7-66)
    • cloning artifact (0-6)
    • cloning artifact (67-72)
  Domains in SCOPe 2.07: d1wgxa1, d1wgxa2, d1wgxa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wgxA (A:)
  gssgssgdkewnekelqklhcafaslpkhkpgfwsevaaavgsrspeecqrkymenprgk
  gsqkhvtsgpssg