PDB entry 1wgw

View 1wgw on RCSB PDB site
Description: Solution Structure of the N-terminal Domain of Mouse Putative Signal Recoginition Particle 54 (SRP54)
Class: signaling protein
Keywords: Signal recognition particle 54 (SRP54), four helical bundle, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 'Signal Recoginition Particle 54
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2410071O21
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14576 (7-92)
      • cloning artifact (0-6)
      • cloning artifact (93-98)
    Domains in SCOPe 2.07: d1wgwa1, d1wgwa2, d1wgwa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wgwA (A:)
    gssgssgadlgrkitsalrslsnatiineevlnamlkevctalleadvniklvkqlrenv
    ksaidleemasglnkrkmiqhavfkelvkvkvysgpssg