PDB entry 1wfw

View 1wfw on RCSB PDB site
Description: Solution structure of SH3 domain of mouse Kalirin-9a protein
Class: signaling protein
Keywords: SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2004-05-27, released 2004-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Kalirin-9a
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 2210407G14
  Database cross-references and differences (RAF-indexed):
  • GB BAB25925 (7-67)
    • cloning artifact (0-6)
    • engineered (28)
    • engineered (56)
    • cloning artifact (68-73)
  Domains in SCOPe 2.08: d1wfwa1, d1wfwa2, d1wfwa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wfwA (A:)
  gssgssgstmtvikdyyalkeneicvsqgevvqvlavnqqnmclvyqpasdhspaaegwv
  pgsilapfsgpssg