PDB entry 1weq

View 1weq on RCSB PDB site
Description: solution structure of phd domain in phd finger protein 7
Deposited on 2004-05-25, released 2004-11-25
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-25, with a file datestamp of 2004-11-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1weqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1weqA (A:)
  gssgssgelepgafselyqryrhcdapiclyeqgrdsfedegrwrlilcatcgshgthrd
  csslrpnskkwecneclpasgpssg