SCOP 1.71: Domain d1weqa_: 1weq A:

Lineage for d1weqa_ (1weq A:)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families)

5. Family g.50.1.2: PHD domain [57911] (12 proteins)

6. Protein PHD finger protein 7 (NYD-SP6) [118338] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [118339] (1 PDB entry)

8. Domain d1weqa_: 1weq A: [114563]
   Structural genomics target
   complexed with zn

Details for d1weqa_

PDB Entry: 1weq

PDB Description: solution structure of phd domain in phd finger protein 7

SCOP Domain Sequences for d1weqa_:

Sequence; same for both SEQRES and ATOM records:

>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus)}
gssgssgelepgafselyqryrhcdapiclyeqgrdsfedegrwrlilcatcgshgthrd
csslrpnskkwecneclpasgpssg

Timeline for d1weqa_:

• d1weqa_ is new in SCOP 1.71
  
• d1weqa_ appears in SCOP 1.73
  
• d1weqa_ appears in the current release, SCOPe 2.08, called d1weqa1