PDB entry 1we7

View 1we7 on RCSB PDB site
Description: Solution structure of Ubiquitin-like domain in SF3a120
Class: gene regulation
Keywords: NMR, structural genomics, Ubiquitin-like domain, SF3a120, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2004-05-24, released 2004-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sf3a1 protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1200014H24
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K4Z5 (7-108)
      • cloning artifact (0-6)
      • cloning artifact (109-114)
    Domains in SCOPe 2.07: d1we7a1, d1we7a2, d1we7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1we7A (A:)
    gssgssgtedslmpeeeflrrnkgpvsikvqvpnmqdktewklngqglvftlpltdqvsv
    ikvkiheatgmpagkqklqyegifikdsnslayynmasgavihlalkersgpssg