SCOP 1.73: Structural Classification of Proteins

PDB entry 1we0

View 1we0 on RCSB PDB site
Description: Crystal structure of peroxiredoxin (AhpC) from Amphibacillus xylanus
Class: oxidoreductase
Keywords: Peroxiredoxin, AhpC
Deposited on 2004-05-21, released 2005-03-29
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0a1
Chain 'B':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0b1
Chain 'C':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0c1
Chain 'D':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0d1
Chain 'E':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0e1
Chain 'F':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0f1
Chain 'G':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0g1
Chain 'H':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0h1
Chain 'I':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0i1
Chain 'J':
Compound: alkyl hydroperoxide reductase C
Species: Amphibacillus xylanus
Database cross-references and differences (RAF-indexed):
- Uniprot O87200 (0-End)
Domains in SCOP 1.73: d1we0j1
Heterogens: NH4

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1we0A (A:)
sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae
lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr
gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevcpakweeggetlkps
ldivgki