Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (28 proteins) |
Protein Alkyl hydroperoxide reductase AhpC [69516] (3 species) |
Species Amphibacillus xylanus [TaxId:1449] [142369] (1 PDB entry) |
Domain d1we0i1: 1we0 I:1-166 [120938] automatically matched to 1WE0 A:1-166 complexed with nh4 |
PDB Entry: 1we0 (more details), 2.9 Å
SCOP Domain Sequences for d1we0i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1we0i1 c.47.1.10 (I:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} sligtevqpfraqafqsgkdffevteadlkgkwsivvfypadfsfvcpteledvqkeyae lkklgvevysvstdthfvhkawhenspavgsieyimigdpsqtisrqfdvlneetgladr gtfiidpdgviqaieinadgigrdastlinkvkaaqyvrenpgevc
Timeline for d1we0i1: