PDB entry 1wd7

View 1wd7 on RCSB PDB site
Description: Crystal Structure of Uroporphyrinogen III Synthase from an Extremely Thermophilic Bacterium Thermus thermophilus HB8 (Wild type, Native, Form-2 crystal)
Class: lyase
Keywords: Uroporphyrinogen, Porphyrin, Heme, Congenital erythropoietic porphyria, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LYASE
Deposited on 2004-05-12, released 2004-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.224
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uroporphyrinogen III Synthase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wd7a1, d1wd7a2
  • Chain 'B':
    Compound: Uroporphyrinogen III Synthase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wd7b1, d1wd7b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wd7A (A:)
    mrrleedavrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgv
    dlflattgvgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgts
    ksllpllpqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeall
    rgevdalafvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvd
    eterlgsllqgfkralqkeva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wd7A (A:)
    avrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflatt
    gvgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpll
    pqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdal
    afvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgs
    llqgfkralqkeva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wd7B (B:)
    mrrleedavrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgv
    dlflattgvgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgts
    ksllpllpqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeall
    rgevdalafvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvd
    eterlgsllqgfkralqkeva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wd7B (B:)
    davrvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflat
    tgvgvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpl
    lpqgrgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevda
    lafvaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlg
    sllqgfkralqkeva