SCOPe 2.08: Domain d1wd7b1: 1wd7 B:10-261

Lineage for d1wd7b1 (1wd7 B:10-261)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.113: HemD-like [69617] (1 superfamily)
   duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.113.1: HemD-like [69618] (1 family)
   automatically mapped to Pfam PF02602

5. Family c.113.1.1: HemD-like [69619] (3 proteins)
   Pfam PF02602

6. Protein Probable uroporphyrinogen-III synthase [117738] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117739] (1 PDB entry)
   Uniprot Q5SKH2; TTHA0671

8. Domain d1wd7b1: 1wd7 B:10-261 [114527]
   Other proteins in same PDB: d1wd7a2, d1wd7b2
   Structural genomics target

Details for d1wd7b1

PDB Entry: 1wd7, 1.6 Å

PDB Description: Crystal Structure of Uroporphyrinogen III Synthase from an Extremely Thermophilic Bacterium Thermus thermophilus HB8 (Wild type, Native, Form-2 crystal)

PDB Compounds: (B:) Uroporphyrinogen III Synthase

SCOPe Domain Sequences for d1wd7b1:

Sequence; same for both SEQRES and ATOM records:

>d1wd7b1 c.113.1.1 (B:10-261) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]}
rvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflattgv
gvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpllpq
grgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdalaf
vaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgsll
qgfkralqkeva

Timeline for d1wd7b1:

• d1wd7b1 first appeared in SCOP 1.71, called d1wd7b_
  
• d1wd7b1 appears in SCOPe 2.07