![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.113: HemD-like [69617] (1 superfamily) duplication: consists of two similar 'swapped' domain with 3 layers (a/b/a) each; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.113.1: HemD-like [69618] (1 family) ![]() automatically mapped to Pfam PF02602 |
![]() | Family c.113.1.1: HemD-like [69619] (3 proteins) Pfam PF02602 |
![]() | Protein Probable uroporphyrinogen-III synthase [117738] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [117739] (1 PDB entry) Uniprot Q5SKH2; TTHA0671 |
![]() | Domain d1wd7b1: 1wd7 B:10-261 [114527] Other proteins in same PDB: d1wd7a2, d1wd7b2 Structural genomics target |
PDB Entry: 1wd7 (more details), 1.6 Å
SCOPe Domain Sequences for d1wd7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wd7b1 c.113.1.1 (B:10-261) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]} rvayaglrrkeafkalaeklgftpllfpvqatekvpvpeyrdqvralaqgvdlflattgv gvrdlleagkalgldlegplakafrlargakaaralkeaglpphavgdgtsksllpllpq grgvaalqlygkplpllenalaergyrvlplmpyrhlpdpegilrleeallrgevdalaf vaaiqveflfegakdpkalrealntrvkalavgrvtadalrewgvkpfyvdeterlgsll qgfkralqkeva
Timeline for d1wd7b1: