PDB entry 1wd2

View 1wd2 on RCSB PDB site
Description: Solution Structure of the C-terminal RING from a RING-IBR-RING (TRIAD) motif
Class: ligase
Keywords: ring, ibr, triad, zinc finger, ligase
Deposited on 2004-05-11, released 2004-07-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ariadne-1 protein homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4X5 (0-58)
      • cloning artifact (59)
    Domains in SCOPe 2.04: d1wd2a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wd2A (A:)
    wiaantkecpkchvtiekdggcnhmvcrnqnckaefcwvclgpwephgsawyncnrynef