PDB entry 1wbc

View 1wbc on RCSB PDB site
Description: crystallization and preliminary x-ray studies of psophocarpin b1, a chymotrypsin inhibitor from winged bean seeds
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1995-11-30, released 1996-04-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.191
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chymotrypsin inhibitor (wci)
  Species: Psophocarpus tetragonolobus [TaxId:3891]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10822 (0-182)
  Domains in SCOPe 2.02: d1wbca_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wbcA (A:)
  dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
  ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
  kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
  ssh