PDB entry 1war

View 1war on RCSB PDB site
Description: recombinant human purple acid phosphatase expressed in pichia pastoris
Class: hydrolase
Keywords: glycoprotein, hydrolase, iron, iron transport, metalloenzyme, purple acid phosphatase, tartrate resistant acid phosphatase, uteroferrin
Deposited on 2004-10-28, released 2005-07-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.141
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human purple acid phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WAR (0-5)
      • conflict (132)
      • conflict (184)
    • Uniprot Q6IAS6 (6-309)
    Domains in SCOPe 2.04: d1wara_
  • Heterogens: FE, PO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1warA (A:)
    eaeaefatpalrfvavgdwggvpnapfhtaremanakeiartvqilgadfilslgdnfyf
    tgvqdindkrfqetfedvfsdrslrkvpwyvlagnhdhlgnvsaqiayskiskrwnfpsp
    fyrlhfkipqtnvsvaifmldtvtlcgnsddflsqqperprdvklartqlswlkkqlaaa
    redyvlvaghypvwsiaehgpthclvkqlrpllatygvtaylcghdhnlqylqdengvgy
    vlsgagnfmdpskrhqrkvpngylrfhygtedslggfayveisskemtvtyieasgkslf
    ktrlprrarp