PDB entry 1wa3

View 1wa3 on RCSB PDB site
Description: Mechanism of the Class I KDPG aldolase
Class: lyase
Keywords: kdpg, pyruvate, lyase
Deposited on 2004-10-22, released 2005-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxy-6-phosphogluconate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wa3a_
  • Chain 'B':
    Compound: 2-keto-3-deoxy-6-phosphogluconate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wa3b_
  • Chain 'C':
    Compound: 2-keto-3-deoxy-6-phosphogluconate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wa3c_
  • Chain 'D':
    Compound: 2-keto-3-deoxy-6-phosphogluconate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wa3d_
  • Chain 'E':
    Compound: 2-keto-3-deoxy-6-phosphogluconate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wa3e_
  • Chain 'F':
    Compound: 2-keto-3-deoxy-6-phosphogluconate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wa3f_
  • Heterogens: PYR, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wa3A (A:)
    mkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflke
    kgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvka
    mklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsa
    lvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa3A (A:)
    kmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkek
    gaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkam
    klghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsal
    vkgtpdevrekakafvekirgc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wa3B (B:)
    mkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflke
    kgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvka
    mklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsa
    lvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa3B (B:)
    kmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkek
    gaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkam
    klghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsal
    vkgtpdevrekakafvekirgc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wa3C (C:)
    mkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflke
    kgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvka
    mklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsa
    lvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa3C (C:)
    meelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkekg
    aiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkamk
    lghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsalv
    kgtpdevrekakafvekirgc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wa3D (D:)
    mkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflke
    kgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvka
    mklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsa
    lvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa3D (D:)
    kmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkek
    gaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkam
    klghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsal
    vkgtpdevrekakafvekirgct
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wa3E (E:)
    mkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflke
    kgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvka
    mklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsa
    lvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa3E (E:)
    kmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkek
    gaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkam
    klghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsal
    vkgtpdevrekakafvekirgc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wa3F (F:)
    mkmeelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflke
    kgaiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvka
    mklghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsa
    lvkgtpdevrekakafvekirgcte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa3F (F:)
    meelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkekg
    aiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkamk
    lghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsalv
    kgtpdevrekakafvekirgc