Lineage for d1wa3f_ (1wa3 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835375Species Thermotoga maritima [TaxId:2336] [186818] (3 PDB entries)
  8. 2835391Domain d1wa3f_: 1wa3 F: [120807]
    automated match to d1vlwb_
    complexed with pyr, so4

Details for d1wa3f_

PDB Entry: 1wa3 (more details), 1.9 Å

PDB Description: Mechanism of the Class I KDPG aldolase
PDB Compounds: (F:) 2-keto-3-deoxy-6-phosphogluconate aldolase

SCOPe Domain Sequences for d1wa3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wa3f_ c.1.10.1 (F:) automated matches {Thermotoga maritima [TaxId: 2336]}
meelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkekg
aiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkamk
lghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsalv
kgtpdevrekakafvekirgc

SCOPe Domain Coordinates for d1wa3f_:

Click to download the PDB-style file with coordinates for d1wa3f_.
(The format of our PDB-style files is described here.)

Timeline for d1wa3f_: