SCOPe 2.08: Domain d1wa3f_: 1wa3 F:

Lineage for d1wa3f_ (1wa3 F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [186818] (3 PDB entries)

8. Domain d1wa3f_: 1wa3 F: [120807]
   automated match to d1vlwb_
   complexed with pyr, so4

Details for d1wa3f_

PDB Entry: 1wa3, 1.9 Å

PDB Description: Mechanism of the Class I KDPG aldolase

PDB Compounds: (F:) 2-keto-3-deoxy-6-phosphogluconate aldolase

SCOPe Domain Sequences for d1wa3f_:

Sequence; same for both SEQRES and ATOM records:

>d1wa3f_ c.1.10.1 (F:) automated matches {Thermotoga maritima [TaxId: 2336]}
meelfkkhkivavlransveeakekalavfeggvhlieitftvpdadtvikelsflkekg
aiigagtvtsveqcrkavesgaefivsphldeeisqfckekgvfympgvmtptelvkamk
lghtilklfpgevvgpqfvkamkgpfpnvkfvptggvnldnvcewfkagvlavgvgsalv
kgtpdevrekakafvekirgc

Timeline for d1wa3f_:

• d1wa3f_ first appeared in SCOP 1.73, called d1wa3f1
  
• d1wa3f_ appears in SCOPe 2.07