PDB entry 1vzw

View 1vzw on RCSB PDB site
Description: crystal structure of the bifunctional protein pria
Class: isomerase
Keywords: isomerase, histidine biosynthesis, tryptophan biosynthesis
Deposited on 2004-05-27, released 2005-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosyl isomerase a
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16250 (Start-239)
    • PDB 1VZW
    Domains in SCOPe 2.07: d1vzwa1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vzwA (A:)
    msklellpavdvrdgqavrlvhgesgtetsygspleaalawqrsgaewlhlvdldaafgt
    gdnraliaevaqamdikvelsggirdddtlaaalatgctrvnlgtaaletpewvakviae
    hgdkiavgldvrgttlrgrgwtrdggdlyetldrlnkegcaryvvtdiakdgtlqgpnle
    llknvcaatdrpvvasggvsslddlraiaglvpagvegaivgkalyakaftleealeats
    lepg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vzwA (A:)
    sklellpavdvrdgqavretsygspleaalawqrsgaewlhlvdldaafgtgdnraliae
    vaqamdikvelsggirdddtlaaalatgctrvnlgtaaletpewvakviaehgdkiavgl
    dvrgttlrgrgwtrdggdlyetldrlnkegcaryvvtdigpnlellknvcaatdrpvvas
    ggvsslddlraiaglvpagvegaivgkalyakaftleealeats