Lineage for d1vzwa1 (1vzw A:2-240)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079054Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 protein domains)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2079082Protein Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA [51368] (2 species)
  7. 2079083Species Streptomyces coelicolor [TaxId:1902] [141744] (1 PDB entry)
    Uniprot P16250 2-240
  8. 2079084Domain d1vzwa1: 1vzw A:2-240 [120553]
    complexed with gol, so4

Details for d1vzwa1

PDB Entry: 1vzw (more details), 1.8 Å

PDB Description: crystal structure of the bifunctional protein pria
PDB Compounds: (A:) phosphoribosyl isomerase a

SCOPe Domain Sequences for d1vzwa1:

Sequence, based on SEQRES records: (download)

>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]}
sklellpavdvrdgqavrlvhgesgtetsygspleaalawqrsgaewlhlvdldaafgtg
dnraliaevaqamdikvelsggirdddtlaaalatgctrvnlgtaaletpewvakviaeh
gdkiavgldvrgttlrgrgwtrdggdlyetldrlnkegcaryvvtdiakdgtlqgpnlel
lknvcaatdrpvvasggvsslddlraiaglvpagvegaivgkalyakaftleealeats

Sequence, based on observed residues (ATOM records): (download)

>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]}
sklellpavdvrdgqavretsygspleaalawqrsgaewlhlvdldaafgtgdnraliae
vaqamdikvelsggirdddtlaaalatgctrvnlgtaaletpewvakviaehgdkiavgl
dvrgttlrgrgwtrdggdlyetldrlnkegcaryvvtdigpnlellknvcaatdrpvvas
ggvsslddlraiaglvpagvegaivgkalyakaftleealeats

SCOPe Domain Coordinates for d1vzwa1:

Click to download the PDB-style file with coordinates for d1vzwa1.
(The format of our PDB-style files is described here.)

Timeline for d1vzwa1: