PDB entry 1vwq

View 1vwq on RCSB PDB site
Description: streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2, ph 2.5, i4122 complex
Deposited on 1997-03-03, released 1998-03-18
The last revision prior to the SCOP 1.59 freeze date was dated 1998-03-18, with a file datestamp of 1998-03-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.59: d1vwqb_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vwqB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    v