PDB entry 1vsk

View 1vsk on RCSB PDB site
Description: asv integrase core domain d64n mutation in citrate buffer ph 6.0
Deposited on 1998-09-18, released 1998-12-02
The last revision prior to the SCOP 1.61 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.159
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1vsk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1vsk_ (-)
glgplqiwqtnftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf