PDB entry 1vsi

View 1vsi on RCSB PDB site
Description: asv integrase core domain with ca(ii) cofactor
Deposited on 1997-03-04, released 1997-05-15
The last revision prior to the SCOP 1.61 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1vsi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vsi_ (-)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
    dgfmkriptskqgellakamyalnhf