PDB entry 1vr7

View 1vr7 on RCSB PDB site
Description: Crystal structure of S-adenosylmethionine decarboxylase proenzyme (TM0655) from THERMOTOGA MARITIMA at 1.2 A resolution
Class: lyase
Keywords: TM0655, S-ADENOSYLMETHIONINE DECARBOXYLASE PROENZYME, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, LYASE
Deposited on 2005-02-15, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylmethionine decarboxylase proenzyme
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZC3
      • modified residue (41)
    Domains in SCOPe 2.07: d1vr7a_
  • Chain 'B':
    Compound: s-adenosylmethionine decarboxylase proenzyme
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0655
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZC3 (12-End)
      • modified residue (12)
      • modified residue (41)
    Domains in SCOPe 2.07: d1vr7b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vr7A (A:)
    mgsdkihhhhhhmkslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhr
    flpygvsgvvviseshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvv
    ehergrydeigipedsphkaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr7A (A:)
    kslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvis
    eshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydeigip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vr7B (B:)
    mgsdkihhhhhhmkslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhr
    flpygvsgvvviseshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvv
    ehergrydeigipedsphkaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr7B (B:)
    mkslgrhlvaefyecdrevldnvqlieqemkqaayesgativtstfhrflpygvsgvvvi
    seshltihtwpeygyaaidlftcgedvdpwkafehlkkalkakrvhvvehergrydei