PDB entry 1vna

View 1vna on RCSB PDB site
Description: proton nuclear magnetic resonance and distance geometry(slash)simulated annealing studies on the variant-1 neurotoxin from the new world scorpion centruroides sculpturatus ewing
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1993-10-26, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin
    Species: Centruroides sculpturatus [TaxId:218467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vnaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vnaA (A:)
    kegylvkksdgckydcfwlgknehcnteckaknqggsygycyafacwceglpestptypl
    pnksc