PDB entry 1vjd

View 1vjd on RCSB PDB site
Description: Structure of pig muscle PGK complexed with ATP
Class: transferase
Keywords: ATP, transferase
Deposited on 2004-02-03, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjda_
  • Heterogens: PO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vjdA (A:)
    slsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaaipsikfcldngaksvvlm
    shlgrpdgipmpdkyslepvavelksllgkdvlflkdcvgpevekacadpaagsvillen
    lrfhveeegkgkdasgskvkadpakieafraslsklgdvyvndafgtahrahssmvgvnl
    pkkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggma
    ftflkvlnnmeigtslfdeegskivkdlmskaekngvkitlpvdfvtadkfdenaktgqa
    tvasgipagwmgldcgpesskkyseavarakqivwngpvgvfeweafaqgtkalmdevvk
    atsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsnv