Lineage for d1vjda_ (1vjd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141948Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2141949Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2141950Family c.86.1.1: Phosphoglycerate kinase [53749] (2 protein domains)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2141951Protein Phosphoglycerate kinase [53750] (8 species)
  7. 2141969Species Pig (Sus scrofa) [TaxId:9823] [64177] (4 PDB entries)
  8. 2141971Domain d1vjda_: 1vjd A: [100806]
    complexed with atp, po4

Details for d1vjda_

PDB Entry: 1vjd (more details), 1.9 Å

PDB Description: Structure of pig muscle PGK complexed with ATP
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d1vjda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjda_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 9823]}
slsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaaipsikfcldngaksvvlm
shlgrpdgipmpdkyslepvavelksllgkdvlflkdcvgpevekacadpaagsvillen
lrfhveeegkgkdasgskvkadpakieafraslsklgdvyvndafgtahrahssmvgvnl
pkkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggma
ftflkvlnnmeigtslfdeegskivkdlmskaekngvkitlpvdfvtadkfdenaktgqa
tvasgipagwmgldcgpesskkyseavarakqivwngpvgvfeweafaqgtkalmdevvk
atsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsnv

SCOPe Domain Coordinates for d1vjda_:

Click to download the PDB-style file with coordinates for d1vjda_.
(The format of our PDB-style files is described here.)

Timeline for d1vjda_: