PDB entry 1vh6

View 1vh6 on RCSB PDB site
Description: Crystal structure of a flagellar protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flagellar protein FliS
    Species: Bacillus subtilis [TaxId:1423]
    Gene: FLIS, BSU35330
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39739
      • modified residue (27)
      • modified residue (48)
      • modified residue (79)
      • modified residue (82)
      • modified residue (86)
      • modified residue (101)
    Domains in SCOPe 2.07: d1vh6a_
  • Chain 'B':
    Compound: flagellar protein FliS
    Species: Bacillus subtilis [TaxId:1423]
    Gene: FLIS, BSU35330
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39739
      • modified residue (27)
      • modified residue (48)
      • modified residue (79)
      • modified residue (82)
      • modified residue (86)
      • modified residue (101)
    Domains in SCOPe 2.07: d1vh6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vh6A (A:)
    mslaiqnpytayqqnsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaq
    niiqelnftlnrnielsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqa
    iqserkdrhgsggiaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh6A (A:)
    atpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrnielsas
    mgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vh6B (B:)
    mslaiqnpytayqqnsvntatpgeltlmlyngclkfirlaaqaienddmerknenlikaq
    niiqelnftlnrnielsasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqa
    iqserkdrhgsggiaeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vh6B (B:)
    vntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrniel
    sasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqse