Lineage for d1vh6b_ (1vh6 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988225Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) (S)
    can form closed, open and helix-swapped bundles
  5. 1988226Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
    automatically mapped to Pfam PF02561
  6. 1988227Protein Flagellar export chaperone FliS [101118] (2 species)
  7. 1988234Species Bacillus subtilis [TaxId:1423] [101120] (1 PDB entry)
  8. 1988236Domain d1vh6b_: 1vh6 B: [100645]
    structural genomics; swapped dimer

Details for d1vh6b_

PDB Entry: 1vh6 (more details), 2.5 Å

PDB Description: Crystal structure of a flagellar protein
PDB Compounds: (B:) flagellar protein FliS

SCOPe Domain Sequences for d1vh6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vh6b_ a.24.19.1 (B:) Flagellar export chaperone FliS {Bacillus subtilis [TaxId: 1423]}
vntatpgeltlmlyngclkfirlaaqaienddmerknenlikaqniiqelnftlnrniel
sasmgamydymyrrlvqanikndtgmlaevegyvtdfrdawkqaiqse

SCOPe Domain Coordinates for d1vh6b_:

Click to download the PDB-style file with coordinates for d1vh6b_.
(The format of our PDB-style files is described here.)

Timeline for d1vh6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vh6a_