PDB entry 1vec

View 1vec on RCSB PDB site
Description: Crystal structure of the N-terminal domain of rck/p54, a human DEAD-box protein
Class: RNA binding protein
Keywords: RNA helicase, dead-box protein, RNA binding protein
Deposited on 2004-03-29, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase p54
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMRCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1veca_
  • Chain 'B':
    Compound: ATP-dependent RNA helicase p54
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMRCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vecb_
  • Heterogens: ZN, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vecA (A:)
    kgnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgaylip
    llerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimrld
    dtvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknrqi
    llysatfplsvqkfmnshlekpyein
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vecB (B:)
    kgnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgaylip
    llerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimrld
    dtvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknrqi
    llysatfplsvqkfmnshlekpyein