Lineage for d1vecb_ (1vec B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870677Protein DEAD box RNA helicase rck/p54 [102387] (1 species)
  7. 2870678Species Human (Homo sapiens) [TaxId:9606] [102388] (1 PDB entry)
  8. 2870680Domain d1vecb_: 1vec B: [100576]
    N-terminal domain only
    complexed with tla, zn

    has additional insertions and/or extensions that are not grouped together

Details for d1vecb_

PDB Entry: 1vec (more details), 2.01 Å

PDB Description: crystal structure of the n-terminal domain of rck/p54, a human dead- box protein
PDB Compounds: (B:) ATP-dependent RNA helicase p54

SCOPe Domain Sequences for d1vecb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vecb_ c.37.1.19 (B:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}
kgnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgaylip
llerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimrld
dtvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknrqi
llysatfplsvqkfmnshlekpyein

SCOPe Domain Coordinates for d1vecb_:

Click to download the PDB-style file with coordinates for d1vecb_.
(The format of our PDB-style files is described here.)

Timeline for d1vecb_: