PDB entry 1vdw

View 1vdw on RCSB PDB site
Description: A hypothetical protein PH1897 from Pyrococcus horikoshii with similarities for Inositol-1 monophosphatase
Deposited on 2004-03-25, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.208
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1vdwa_
  • Chain 'B':
    Domains in SCOP 1.67: d1vdwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vdwA (A:)
    msvktwrkiaidiirdfdhnimplfgnpkasetisispsgdetkvvdkvaeniiiskfkd
    lgvnvvseeigridqgsdytvvvdpldgsynfingipffavsvaifhekdpiyafiyepi
    verlyegipgkgsylngekikvrelaekpsisfytkgkgtkiidkvkrtrtlgaialela
    ylargaldavvdirnylrptdiaagvviareagaivkdldgkdveitfsatekvniiaan
    neelletilrsiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdwA (A:)
    svktwrkiaidiirdfdhnimplfgnpkasetisietkvvdkvaeniiiskfkdlgvnvv
    seeigridqgsdytvvvdpldgsynfingipffavsvaifhekdpiyafiyepiverlye
    gipgkgsylngekikvrelaekpsisfytkgkgtkiidkvkrtrtlgaialelaylarga
    ldavvdirnylrptdiaagvviareagaivkdldgkdveitfsatekvniiaanneelle
    tilrsiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vdwB (B:)
    msvktwrkiaidiirdfdhnimplfgnpkasetisispsgdetkvvdkvaeniiiskfkd
    lgvnvvseeigridqgsdytvvvdpldgsynfingipffavsvaifhekdpiyafiyepi
    verlyegipgkgsylngekikvrelaekpsisfytkgkgtkiidkvkrtrtlgaialela
    ylargaldavvdirnylrptdiaagvviareagaivkdldgkdveitfsatekvniiaan
    neelletilrsiek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vdwB (B:)
    svktwrkiaidiirdfdhnimplfgnpkasetisdetkvvdkvaeniiiskfkdlgvnvv
    seeigridqgsdytvvvdpldgsynfingipffavsvaifhekdpiyafiyepiverlye
    gipgkgsylngekikvrelaekpsisfytkgkgtkiidkvkrtrtlgaialelaylarga
    ldavvdirnylrptdiaagvviareagaivkdldgkdveitfsatekvniiaanneelle
    tilrsiek