Lineage for d1vdwb_ (1vdw B:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424284Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 424285Superfamily e.7.1: Carbohydrate phosphatase [56655] (2 families) (S)
  5. 424286Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (6 proteins)
  6. 424295Protein Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase [56665] (3 species)
  7. 424314Species Archaeon Pyrococcus horikoshii [TaxId:53953] [103398] (1 PDB entry)
    PH1897
  8. 424316Domain d1vdwb_: 1vdw B: [100570]
    structural genomics
    complexed with egl

Details for d1vdwb_

PDB Entry: 1vdw (more details), 1.3 Å

PDB Description: A hypothetical protein PH1897 from Pyrococcus horikoshii with similarities for Inositol-1 monophosphatase

SCOP Domain Sequences for d1vdwb_:

Sequence, based on SEQRES records: (download)

>d1vdwb_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Pyrococcus horikoshii}
svktwrkiaidiirdfdhnimplfgnpkasetisispsgdetkvvdkvaeniiiskfkdl
gvnvvseeigridqgsdytvvvdpldgsynfingipffavsvaifhekdpiyafiyepiv
erlyegipgkgsylngekikvrelaekpsisfytkgkgtkiidkvkrtrtlgaialelay
largaldavvdirnylrptdiaagvviareagaivkdldgkdveitfsatekvniiaann
eelletilrsiek

Sequence, based on observed residues (ATOM records): (download)

>d1vdwb_ e.7.1.1 (B:) Archaeal inositol monophosphatase/fructose-1,6-bisphosphatase {Archaeon Pyrococcus horikoshii}
svktwrkiaidiirdfdhnimplfgnpkasetisdetkvvdkvaeniiiskfkdlgvnvv
seeigridqgsdytvvvdpldgsynfingipffavsvaifhekdpiyafiyepiverlye
gipgkgsylngekikvrelaekpsisfytkgkgtkiidkvkrtrtlgaialelaylarga
ldavvdirnylrptdiaagvviareagaivkdldgkdveitfsatekvniiaanneelle
tilrsiek

SCOP Domain Coordinates for d1vdwb_:

Click to download the PDB-style file with coordinates for d1vdwb_.
(The format of our PDB-style files is described here.)

Timeline for d1vdwb_: