PDB entry 1vdd

View 1vdd on RCSB PDB site
Description: Crystal structure of recombinational repair protein RecR
Class: recombination
Keywords: Helix-hairpin-helix, zinc finger, toprim, Walker B ATP binding motif, RECOMBINATION
Deposited on 2004-03-20, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombination protein recr
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: recR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vdda_
  • Chain 'B':
    Compound: recombination protein recr
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: recR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vddb_
  • Chain 'C':
    Compound: recombination protein recr
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: recR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vddc_
  • Chain 'D':
    Compound: recombination protein recr
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: recR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vddd_
  • Heterogens: ZN, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vddA (A:)
    mkyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpic
    fnitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpd
    klhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsley
    tdevtlgraltgrqtvskpqppqrpgdedgadgaavpasrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vddA (A:)
    mkyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpic
    fnitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpd
    klhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsley
    tdevtlgraltgrqtvskp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vddB (B:)
    mkyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpic
    fnitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpd
    klhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsley
    tdevtlgraltgrqtvskpqppqrpgdedgadgaavpasrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vddB (B:)
    kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf
    nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk
    lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt
    devtlgraltgrqtvskp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vddC (C:)
    mkyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpic
    fnitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpd
    klhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsley
    tdevtlgraltgrqtvskpqppqrpgdedgadgaavpasrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vddC (C:)
    kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf
    nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk
    lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt
    devtlgraltgrqtvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vddD (D:)
    mkyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpic
    fnitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpd
    klhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsley
    tdevtlgraltgrqtvskpqppqrpgdedgadgaavpasrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vddD (D:)
    kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf
    nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk
    lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt
    devtlgraltgrqtvskp