PDB entry 1vcs

View 1vcs on RCSB PDB site
Description: Solution Structure of RSGI RUH-009, an N-Terminal Domain of Vti1a [Mus musculus]
Class: structural genomics, unknown function
Keywords: SNARE, Habc domain, Vti1, up and down three helix bundle, left-handed twist, vesicle transport, membrane fusion, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-03-10, released 2005-05-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vesicle transport through interaction with t-SNAREs homolog 1A
    Species: Mus musculus [TaxId:10090]
    Gene: Mus musculus adult male lung cDNA, RIKEN full-length enriched library, clone:1200014A22 product: Vti1a (amino acid 6-94)
    Database cross-references and differences (RAF-indexed):
    • Uniprot O89116 (7-95)
      • cloning artifact (0-6)
      • cloning artifact (96-101)
    Domains in SCOPe 2.08: d1vcsa1, d1vcsa2, d1vcsa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vcsA (A:)
    gssgssgegyeqdfavltaeitskiarvprlppdekkqmvanvekqleearelleqmdle
    vreippqsrgmysnrmrsykqemgkletdfkrsriasgpssg