Lineage for d1vcsa1 (1vcs A:8-96)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714459Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2714477Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 2714478Family a.47.2.1: t-snare proteins [47662] (6 proteins)
  6. 2714499Protein Vesicle transport v-SNARE protein Vti1-like 2 [140564] (1 species)
    three-helical fragment similar to spectrin repeat
  7. 2714500Species Mouse (Mus musculus) [TaxId:10090] [140565] (1 PDB entry)
    Uniprot O89116 6-94
  8. 2714501Domain d1vcsa1: 1vcs A:8-96 [119985]
    Other proteins in same PDB: d1vcsa2, d1vcsa3
    missing some secondary structures that made up less than one-third of the common domain

Details for d1vcsa1

PDB Entry: 1vcs (more details)

PDB Description: solution structure of rsgi ruh-009, an n-terminal domain of vti1a [mus musculus]
PDB Compounds: (A:) Vesicle transport through interaction with t-SNAREs homolog 1A

SCOPe Domain Sequences for d1vcsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcsa1 a.47.2.1 (A:8-96) Vesicle transport v-SNARE protein Vti1-like 2 {Mouse (Mus musculus) [TaxId: 10090]}
egyeqdfavltaeitskiarvprlppdekkqmvanvekqleearelleqmdlevreippq
srgmysnrmrsykqemgkletdfkrsria

SCOPe Domain Coordinates for d1vcsa1:

Click to download the PDB-style file with coordinates for d1vcsa1.
(The format of our PDB-style files is described here.)

Timeline for d1vcsa1: