![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
![]() | Superfamily a.47.2: t-snare proteins [47661] (1 family) ![]() |
![]() | Family a.47.2.1: t-snare proteins [47662] (6 proteins) |
![]() | Protein Vesicle transport v-SNARE protein Vti1-like 2 [140564] (1 species) three-helical fragment similar to spectrin repeat |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140565] (1 PDB entry) Uniprot O89116 6-94 |
![]() | Domain d1vcsa1: 1vcs A:8-96 [119985] Other proteins in same PDB: d1vcsa2, d1vcsa3 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1vcs (more details)
SCOPe Domain Sequences for d1vcsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcsa1 a.47.2.1 (A:8-96) Vesicle transport v-SNARE protein Vti1-like 2 {Mouse (Mus musculus) [TaxId: 10090]} egyeqdfavltaeitskiarvprlppdekkqmvanvekqleearelleqmdlevreippq srgmysnrmrsykqemgkletdfkrsria
Timeline for d1vcsa1: