PDB entry 1v9b

View 1v9b on RCSB PDB site
Description: Crystal Structure of Pyrococcus Horikoshii CutA1 complexed with Co2+
Class: Structural genomics, unknown function
Keywords: CutA, Trimer, Divalent cation tolerance, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2004-01-23, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic divalent cation tolerance protein cutA
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0992
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58720 (0-101)
      • modified residue (28)
    Domains in SCOPe 2.08: d1v9ba_
  • Chain 'B':
    Compound: Periplasmic divalent cation tolerance protein cutA
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0992
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58720 (0-101)
      • modified residue (28)
    Domains in SCOPe 2.08: d1v9bb_
  • Chain 'C':
    Compound: Periplasmic divalent cation tolerance protein cutA
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0992
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58720 (0-101)
      • modified residue (28)
    Domains in SCOPe 2.08: d1v9bc_
  • Chain 'D':
    Compound: Periplasmic divalent cation tolerance protein cutA
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0992
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58720 (0-101)
      • modified residue (28)
    Domains in SCOPe 2.08: d1v9bd_
  • Chain 'E':
    Compound: Periplasmic divalent cation tolerance protein cutA
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0992
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58720 (0-101)
      • modified residue (28)
    Domains in SCOPe 2.08: d1v9be_
  • Chain 'F':
    Compound: Periplasmic divalent cation tolerance protein cutA
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: PH0992
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58720 (0-101)
      • modified residue (28)
    Domains in SCOPe 2.08: d1v9bf_
  • Heterogens: CO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v9bA (A:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v9bB (B:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v9bC (C:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v9bD (D:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v9bE (E:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v9bF (F:)
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk