Lineage for d1v9bc_ (1v9b C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950720Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2950721Protein Cut A1 [89931] (5 species)
  7. 2950749Species Pyrococcus horikoshii [TaxId:53953] [102974] (10 PDB entries)
    Uniprot O58720
  8. 2950761Domain d1v9bc_: 1v9b C: [303215]
    automated match to d1ukua_
    complexed with co, so4

Details for d1v9bc_

PDB Entry: 1v9b (more details), 2 Å

PDB Description: Crystal Structure of Pyrococcus Horikoshii CutA1 complexed with Co2+
PDB Compounds: (C:) Periplasmic divalent cation tolerance protein cutA

SCOPe Domain Sequences for d1v9bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9bc_ d.58.5.2 (C:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]}
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

SCOPe Domain Coordinates for d1v9bc_:

Click to download the PDB-style file with coordinates for d1v9bc_.
(The format of our PDB-style files is described here.)

Timeline for d1v9bc_: