PDB entry 1v8x

View 1v8x on RCSB PDB site
Description: Crystal Structure of the Dioxygen-bound Heme Oxygenase from Corynebacterium diphtheriae
Class: oxidoreductase
Keywords: PROTEIN-HEME COMPLEX, HELIX, OXY, Oxidoreductase
Deposited on 2004-01-15, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • see remark 999 (191)
    Domains in SCOPe 2.07: d1v8xa_
  • Chain 'B':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • see remark 999 (191)
    Domains in SCOPe 2.07: d1v8xb_
  • Chain 'C':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • see remark 999 (191)
    Domains in SCOPe 2.07: d1v8xc_
  • Heterogens: SUC, SO4, HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8xA (A:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8xA (A:)
    taglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavr
    asgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpa
    lvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnle
    lsdeqrehllkeatdafvfnhqvfadlgkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8xB (B:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8xB (B:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgkgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v8xC (C:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8xC (C:)
    aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
    sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
    vahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
    sdeqrehllkeatdafvfnhqvfadlgk