PDB entry 1v87

View 1v87 on RCSB PDB site
Description: Solution Structure of the Ring-H2 Finger Domain of Mouse Deltex Protein 2
Class: metal binding protein
Keywords: Ring-H2 Domain, Zinc-Binding Domain, Notch signaling, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2003-12-29, released 2004-06-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deltex protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 2610524D08
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R3P2 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
    Domains in SCOPe 2.04: d1v87a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v87A (A:)
    gssgssgepeqvirkyteelkvapeedciicmeklavasgysdmtdskalgpmvvgrltk
    cshafhllcllamycngnkdgslqcpscktiygektgtqpwgkmevfrsgpssg