PDB entry 1v64

View 1v64 on RCSB PDB site
Description: Solution structure of the 3rd HMG box of mouse UBF1
Class: transcription
Keywords: Transcription factor, DNA binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-11-27, released 2004-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleolar transcription factor 1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1300010N03
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25976 (7-101)
      • cloning artifact (0-6)
      • cloning artifact (102-107)
    Domains in SCOPe 2.07: d1v64a1, d1v64a2, d1v64a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v64A (A:)
    gssgssgqlkdkfdgrptkpppnsyslycaelmanmkdvpstermvlcsqqwkllsqkek
    dayhkkcdqkkkdyevellrfleslpeeeqqrvlgeekmlnisgpssg