Lineage for d1v64a1 (1v64 A:8-102)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986423Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1986424Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1986425Family a.21.1.1: HMG-box [47096] (10 protein domains)
  6. 1986457Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
    Contains 6 HMG-box domains
  7. 1986462Species Mouse (Mus musculus) [TaxId:10090] [109764] (3 PDB entries)
    Uniprot P25976 388-383, 392-470, 567-655
  8. 1986463Domain d1v64a1: 1v64 A:8-102 [108392]
    Other proteins in same PDB: d1v64a2, d1v64a3
    Structural genomics target, HMG box 3

Details for d1v64a1

PDB Entry: 1v64 (more details)

PDB Description: Solution structure of the 3rd HMG box of mouse UBF1
PDB Compounds: (A:) Nucleolar transcription factor 1

SCOPe Domain Sequences for d1v64a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v64a1 a.21.1.1 (A:8-102) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]}
qlkdkfdgrptkpppnsyslycaelmanmkdvpstermvlcsqqwkllsqkekdayhkkc
dqkkkdyevellrfleslpeeeqqrvlgeekmlni

SCOPe Domain Coordinates for d1v64a1:

Click to download the PDB-style file with coordinates for d1v64a1.
(The format of our PDB-style files is described here.)

Timeline for d1v64a1: