PDB entry 1v62

View 1v62 on RCSB PDB site
Description: Solution structure of the 3rd PDZ domain of GRIP2
Class: protein binding
Keywords: structural genomics, synaptic transmission, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2003-11-27, released 2004-05-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1719 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA pf00330s1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9C0E4 (7-110)
    • cloning artifact (0-6)
    • cloning artifact (111-116)
  Domains in SCOPe 2.04: d1v62a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v62A (A:)
  gssgssgdtvanasgplmveivktpgsalgisltttslrnksvitidrikpasvvdrsga
  lhpgdhilsidgtsmehcslleatkllasisekvrleilpvpqsqrplrpssgpssg